Prokaryotic ubiquitin-like protein

Pup-like protein family

Three Prokaryotic ubiquitin-like proteins (blue) attached to proteasomal ATPase Mpa (red)
Identifiers
Symbol Pup/Mpa PDB:3M9D
Pfam PF05639

Prokaryotic ubiquitin-like protein (Pup) is a functional analog of ubiquitin found in the prokaryote Mycobacterium tuberculosis.[1] It serves the same function as ubiquitin, although the enzymology of ubiquitylation and pupylation is different. In contrast to the three-step reaction of ubiquitylation, pupylation requires two steps, therefore only two enzymes are involved in pupylation. Similar to ubiquitin, Pup attaches to specific lysine residues of substrate proteins by forming isopeptide bonds. It is then recognized by Mycobacterium proteasomal ATPase (Mpa) by a binding-induced folding mechanism[2] that forms a unique alpha-helix. Mpa then delivers the Pup-substrate to the 20S proteasome by coupling of ATP hydrolysis for proteasomal degradation.

The discovery of Pup indicates that like eukaryotes, bacteria may use a small-protein modifier to control protein stability.

The X-ray crystal structure of the Pup/Mpa complex (PDB: 3M9D) was first determined by scientists Tao Wang and Huilin Li of the Brookhaven National Laboratory.[3]

The Pup gene encodes a 64–amino acid protein with a molecular size of 6.944 kDa:

MAQEQTKRGGGGGDDDDIAGSTAAGQERREKLTEETDDLLDEIDDVLEENAEDFVRAYVQKGGQ[4]

See also

References

  1. ↑ Pearce, M. J.; Mintseris, J.; Ferreyra, J.; Gygi, S. P.; Darwin, K. H. (2008). "Ubiquitin-Like Protein Involved in the Proteasome Pathway of Mycobacterium tuberculosis". Science. 322 (5904): 1104–1107. doi:10.1126/science.1163885. PMC 2698935Freely accessible. PMID 18832610.
  2. ↑ Wang T, Darwin KH, Li H. Binding-induced folding of prokaryotic ubiquitin-like protein on the Mycobacterium proteasomal ATPase targets substrates for degradation.Nat Struct Mol Biol. 2010 Nov;17(11):1352-7. doi: 10.1038/nsmb.1918.
  3. ↑ http://www.bnl.gov/newsroom/news.php?a=11221
  4. ↑ http://www.uniprot.org/uniprot/P9WHN4#section_seq
This article is issued from Wikipedia - version of the 9/19/2016. The text is available under the Creative Commons Attribution/Share Alike but additional terms may apply for the media files.